PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g023540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TALE
Protein Properties Length: 562aa    MW: 63336.3 Da    PI: 6.4615
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g023540.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.8e-103924291954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Csa03g023540.1 392 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 429
                     664459******************************88 PP

2BELL93.52e-302643231372
            BELL  13 lslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      s+  +VdkrY+qy++q+++++ssFe+vaglgsakpYts+Al++iSrhFr+L+dai+eqi
  Csa03g023540.1 264 GSVSVKVDKRYNQYYHQMEALASSFEIVAGLGSAKPYTSVALNRISRHFRALRDAIKEQI 323
                     566679*****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.2E-40161321IPR006563POX domain
PfamPF075265.5E-43167319IPR006563POX domain
PROSITE profilePS5007112.455370433IPR001356Homeobox domain
CDDcd000864.76E-12373434No hitNo description
SMARTSM003895.4E-10373437IPR001356Homeobox domain
SuperFamilySSF466891.84E-17374440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-28376439IPR009057Homeodomain-like
PfamPF059207.1E-18390429IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MAVYYTSNVG CYQQEPIFLN HQQQQQQQQA SSSSAAASFT VTGGDNVRNE MVFIPPTTGD  60
VVTVNGAVSS SDLSFHDGQG LSLSLGTQIS VPPFQYHQYQ LGFTQNPSLS SVKETSTYNV  120
DEMSVKSKEM LLLGQSDPSS VYAGNGGNGF YNNYRYNETS GGFMSGVLRS RYLKPAQSLL  180
DEVVSVKKEL NQMGNKKMKV NDFNNGSKEI GRGGSGELSS DSNGKSIELS TVEREELQNK  240
KNKLMTMVDE VTNLHLLKLV LQLGSVSVKV DKRYNQYYHQ MEALASSFEI VAGLGSAKPY  300
TSVALNRISR HFRALRDAIK EQIQIIRDKL GEKGGESLDD QQGERIPRLR YLDQRLRQQR  360
ALHQQLGMVR PAWRPQRGLP ENSVSVLRAW LFEHFLHPYP KESEKIMLAK QTGLSKNQVA  420
NWFINARVRL WKPMIEEMYK EEFGDESELL ISKSSQELNS TNQEDSSSQQ QQQQENNNNH  480
LAYSSVDTTN IAFSSEIKPD RVSGNDDEPQ QQQQQQMNRS ADYDTLMNYQ GFGLDDYRYI  540
GGSNQQESRY SNSHHLHDFV V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16379437563Homeobox protein Meis2
3k2a_B4e-16379437563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010498393.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLR0GWD70.0R0GWD7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10